PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_18426A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 304aa    MW: 32224.2 Da    PI: 9.4641
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_18426AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.76.3e-191156147
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                               +g+W++eEde l ++v+++G ++W++I r ++ gR++k+c++rw + 
  Oropetium_20150105_18426A 11 KGPWSPEEDEALRRLVERHGARNWTAIGRGIP-GRSGKSCRLRWCNQ 56
                               79******************************.***********985 PP

2Myb_DNA-binding55.81.1e-1763106146
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                r ++T+eEd  +++a+++lG++ W++Iar ++ gRt++ +k++w++
  Oropetium_20150105_18426A  63 RRPFTPEEDATILRAHARLGNR-WAAIARLLP-GRTDNAVKNHWNS 106
                                679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.481661IPR017930Myb domain
SuperFamilySSF466897.86E-328104IPR009057Homeodomain-like
SMARTSM007179.6E-171059IPR001005SANT/Myb domain
PfamPF002493.9E-181156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-251264IPR009057Homeodomain-like
CDDcd001673.93E-161355No hitNo description
SMARTSM007175.5E-1662110IPR001005SANT/Myb domain
PfamPF002498.3E-1663106IPR001005SANT/Myb domain
PROSITE profilePS5129421.54263112IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-2465112IPR009057Homeodomain-like
CDDcd001671.03E-1265108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MGAEAECDRI KGPWSPEEDE ALRRLVERHG ARNWTAIGRG IPGRSGKSCR LRWCNQLSPQ  60
VERRPFTPEE DATILRAHAR LGNRWAAIAR LLPGRTDNAV KNHWNSSLKR KLSTATAATP  120
TNLEAGDAEA AERPCKRVSP GPGSPTGSDR SELSHSSVGG GGGAQVFRPV PRTGGFDAIS  180
APEVRPPPPR DEDPLTSLSL SLPGQDQASS GFRHDSARSR FHELSPSRSP SPPSPPTPAA  240
PSPYPFSGEL VAAMQEMIRA EVRKYMSGAG LPAGCGPGAV GEACIVEGVM RAAAERVGVI  300
TRQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-4281144110B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00653PBMTransfer from LOC_Os02g09480Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001147631.11e-153uncharacterized protein LOC100281240
SwissprotQ9FDW13e-71MYB44_ARATH; Transcription factor MYB44
TrEMBLM0YXY71e-154M0YXY7_HORVD; Uncharacterized protein
TrEMBLQ27W751e-154Q27W75_WHEAT; MYB transcription factor TaMYB1
STRINGMLOC_7426.11e-153(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.13e-71myb domain protein r1